PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G150500.1
Common NameB456_012G150500, LOC105780549
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 397aa    MW: 44811.2 Da    PI: 8.0969
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G150500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.51.3e-32248303156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W++eLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Gorai.012G150500.1 248 KQRRCWSSELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 303
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.602245305IPR017930Myb domain
SuperFamilySSF466891.19E-17246306IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-29246306IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-27248303IPR006447Myb domain, plants
PfamPF002494.0E-7250301IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MGSVPSELSL DFRPKFIPKT ISNFLEEISL MGSVSDKISK LDSFVKRLEE EMRKIDGFKR  60
ELPLSMLLLN DAILALKEES TQCVRRRNVE PVLEEFIPLK NNQKENNNHS DEEEEEEEED  120
DSKKNWMSSV QLWNTDDDDY SSIDDKLDTK RNHGDPFKNR GKVRGFMPFK ANLSFAVKKE  180
EKREIPIHGL TILTPGIKNP KVELGFTESR MSRSRAASYS SLKGQVNFRS ELQPLSDLQR  240
QQQQATRKQR RCWSSELHRR FVNALQQLGG SQVATPKQIR ELMQVDGLTN DEVKSHLQKY  300
RLHTRRLPPS TRTTTTPANQ SALVLGNGLC MSHDPYGDSS KGSSSQSGSP QGPLQLATNT  360
GGTSTTRGDS TEDEEDAKSE AYSWKTPTHK PLKGNV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460398.10.0PREDICTED: kinesin-like protein KIF21A
RefseqXP_012460400.10.0PREDICTED: kinesin-like protein KIF21A
TrEMBLA0A0D2VZN70.0A0A0D2VZN7_G
STRINGVIT_03s0063g01060.t011e-142(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145351021
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-44G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]